Mouse NSE(Enolase, Neuron Specific) ELISA Kit

Mouse NSE(Enolase, Neuron Specific) ELISA Kit

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Mu-96Tests	Reddot Biotech	96 Tests	EUR 677

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Mu-48Tests	Reddot Biotech	48 Tests	EUR 511

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Mu-96Tests	Reddot Biotech	96 Tests	EUR 709

Human Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Hu-48T	DL Develop	48T	EUR 479
Should the Human Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Hu-96T	DL Develop	96T	EUR 621
Should the Human Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Ra-48T	DL Develop	48T	EUR 508
Should the Rat Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Ra-96T	DL Develop	96T	EUR 661
Should the Rat Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Rb-48T	DL Develop	48T	EUR 508
Should the Rabbit Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rabbit Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates or other biological fluids.

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Rb-96T	DL Develop	96T	EUR 661
Should the Rabbit Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rabbit Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates or other biological fluids.

Human Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Hu-48Tests	Reddot Biotech	48 Tests	EUR 478

Human Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Hu-96Tests	Reddot Biotech	96 Tests	EUR 662

Rat Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Ra-48Tests	Reddot Biotech	48 Tests	EUR 511

Rat Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Ra-96Tests	Reddot Biotech	96 Tests	EUR 709

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Rb-48Tests	Reddot Biotech	48 Tests	EUR 511

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Rb-96Tests	Reddot Biotech	96 Tests	EUR 709

Human Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Hu-48Tests	Reddot Biotech	48 Tests	EUR 500

Human Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Hu-96Tests	Reddot Biotech	96 Tests	EUR 692

Rat Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Ra-48Tests	Reddot Biotech	48 Tests	EUR 534

Rat Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Ra-96Tests	Reddot Biotech	96 Tests	EUR 742

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Rb-48Tests	Reddot Biotech	48 Tests	EUR 534

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Rb-96Tests	Reddot Biotech	96 Tests	EUR 742

Neuron Specific Enolase (NSE)
CH22126	Neuromics	100 ul of serum	EUR 409

Mouse Neuron-specific enolase(NSE)ELISA Kit
GA-E0582MS-48T	GenAsia Biotech	48T	EUR 336

Mouse Neuron-specific enolase(NSE)ELISA Kit
GA-E0582MS-96T	GenAsia Biotech	96T	EUR 534

Mouse NSE(Neuron-Specific Enolase) ELISA Kit
EM1242	FN Test	96T	EUR 476.25
Detection range: 78.125-5000 pg/ml Uniprot ID: P17183 Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 46.875pg/ml

Mouse Neuron-specific enolase, NSE ELISA Kit
CSB-E07962m-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Neuron-specific enolase, NSE in samples from serum, plasma, cell culture supernates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Neuron-specific enolase, NSE ELISA Kit
1-CSB-E07962m	Cusabio	EUR 703.00 EUR 4843.00 EUR 2570.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Neuron-specific enolase, NSE in samples from serum, plasma, cell culture supernates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Neuron-specific enolase,NSE ELISA Kit
CN-02346M1	ChemNorm	96T	EUR 439

Mouse Neuron-specific enolase,NSE ELISA Kit
CN-02346M2	ChemNorm	48T	EUR 290

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4391.16
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 449.27
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 598.96
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2395.32
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Enolase, Neuron Specific (NSE) ELISA Kit
4-SEA537Mu	Cloud-Clone	EUR 4442.00 EUR 2346.00 EUR 599.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2 Enolase 2 Gamma Enolase 2-phospho-D-glycerate hydro-lyase Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Enolase, Neuron Specific (NSE) in samples from Serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Neuron-specific enolase(NSE)ELISA Kit
QY-E21075	Qayee Biotechnology	96T	EUR 361

Enolase, Neuron Specific (NSE) Antibody
20-abx129524	Abbexa	EUR 411.00 EUR 133.00 EUR 1135.00 EUR 551.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-12 working days.

Enolase, Neuron Specific (NSE) Antibody
20-abx102347	Abbexa	EUR 398.00 EUR 133.00 EUR 1107.00 EUR 537.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Enolase, Neuron Specific (NSE) Antibody
20-abx102348	Abbexa	EUR 398.00 EUR 133.00 EUR 1107.00 EUR 537.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Enolase, Neuron Specific (NSE) Antibody
20-abx102349	Abbexa	EUR 411.00 EUR 133.00 EUR 1135.00 EUR 551.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Enolase, Neuron Specific (NSE) Antibody
20-abx102350	Abbexa	EUR 425.00 EUR 133.00 EUR 1177.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Neuron-Specific Enolase (NSE) Antibody
abx037440-100ug	Abbexa	100 ug	EUR 391
Shipped within 5-10 working days.

Neuron-Specific Enolase (NSE) Antibody
abx037802-100ug	Abbexa	100 ug	EUR 391
Shipped within 5-10 working days.

Neuron Specific Enolase (NSE) Antibody
abx020636-1mg	Abbexa	1 mg	EUR 829
Shipped within 5-10 working days.

Neuron Specific Enolase (NSE) Antibody
abx020637-1mg	Abbexa	1 mg	EUR 829
Shipped within 5-10 working days.

Neuron Specific Enolase (NSE) Antibody
abx020638-1mg	Abbexa	1 mg	EUR 829
Shipped within 5-10 working days.

Neuron Specific Enolase (NSE) Antibody
abx020639-1mg	Abbexa	1 mg	EUR 829
Shipped within 5-10 working days.

Neuron Specific Enolase (NSE) Antibody
abx020640-1mg	Abbexa	1 mg	EUR 829
Shipped within 5-10 working days.

Neuron Specific Enolase (NSE) Antibody
abx020641-1mg	Abbexa	1 mg	EUR 829
Shipped within 5-10 working days.

Enolase, Neuron Specific (NSE) Antibody
20-abx172246	Abbexa	EUR 843.00 EUR 439.00	1 mg 200 ug
Please enquire.

Enolase, Neuron Specific (NSE) Antibody
20-abx172247	Abbexa	EUR 843.00 EUR 439.00	1 mg 200 ug
Please enquire.

Neuron-Specific Enolase (NSE) Antibody
abx411075-02mg	Abbexa	0.2 mg	EUR 565
Shipped within 1 week.

Neuron-Specific Enolase (NSE) Antibody
abx411512-02mg	Abbexa	0.2 mg	EUR 565
Shipped within 1 week.

Enolase, Neuron Specific (NSE) Antibody
20-abx270247	Abbexa	EUR 467.00 EUR 537.00 EUR 272.00 EUR 815.00 EUR 356.00	100 tests 200 tests 25 tests 500 tests 50 tests
Shipped within 5-7 working days.

Neuron-Specific Enolase (NSE) Antibody
abx235865-100ug	Abbexa	100 ug	EUR 481
Shipped within 5-12 working days.

Neuron-Specific Enolase (NSE) Antibody
abx235866-100ug	Abbexa	100 ug	EUR 481
Shipped within 5-12 working days.

Neuron-Specific Enolase (NSE) Antibody
abx235867-100ug	Abbexa	100 ug	EUR 509
Shipped within 5-12 working days.

Neuron Specific Enolase (NSE)/ENO2
CH23003	Neuromics	100 ul	EUR 179

Recombinant Enolase, Neuron Specific (NSE)
4-RPA537Hu01	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P09104 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 49.0kDa Isoelectric Point: 5.1
Description: Recombinant Human Enolase, Neuron Specific expressed in: E.coli

Recombinant Enolase, Neuron Specific (NSE)
4-RPA537Hu02	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Q6IFW5 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 37.1kDa Isoelectric Point: 5.1
Description: Recombinant Human Enolase, Neuron Specific expressed in: E.coli

Recombinant Enolase, Neuron Specific (NSE)
4-RPA537Mu01	Cloud-Clone	EUR 440.48 EUR 221.00 EUR 1376.80 EUR 525.60 EUR 951.20 EUR 358.00 EUR 3292.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Q545V3 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 36.1kDa Isoelectric Point: 5.2
Description: Recombinant Mouse Enolase, Neuron Specific expressed in: E.coli

Recombinant Enolase, Neuron Specific (NSE)
4-RPA537Mu02	Cloud-Clone	EUR 440.48 EUR 221.00 EUR 1376.80 EUR 525.60 EUR 951.20 EUR 358.00 EUR 3292.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Q545V3 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 48.7kDa Isoelectric Point: 5.2
Description: Recombinant Mouse Enolase, Neuron Specific expressed in: E.coli

Recombinant Enolase, Neuron Specific (NSE)
4-RPA537Ra01	Cloud-Clone	EUR 440.48 EUR 221.00 EUR 1376.80 EUR 525.60 EUR 951.20 EUR 358.00 EUR 3292.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P07323 Buffer composition: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 48.5kDa Isoelectric Point: 5.3
Description: Recombinant Rat Enolase, Neuron Specific expressed in: E.coli

Neuron Specific Enolase (NSE)/ENO2
RA22110	Neuromics	100 ul	EUR 409

Mouse Enolase, Neuron Specific (NSE) Protein
20-abx066424	Abbexa	EUR 620.00 EUR 272.00 EUR 1859.00 EUR 732.00 EUR 453.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Mouse Enolase, Neuron Specific (NSE) Protein
20-abx167196	Abbexa	EUR 620.00 EUR 272.00 EUR 1859.00 EUR 732.00 EUR 453.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Neuron Specific Enolase (NSE) ELISA
LF-EK0169	Abfrontier	1×96T	EUR 603

Mouse Neuron-Specific Enolase (NSE) CLIA Kit
abx197339-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Human NSE(Neuron-specific Enolase) ELISA Kit
EH0370	FN Test	96T	EUR 476.25
Detection range: 2.344-150 ng/ml Uniprot ID: P09104 Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 1.406 ng/ml

Human Neuron-specific enolase(NSE)ELISA Kit
GA-E0954HM-48T	GenAsia Biotech	48T	EUR 289

Human Neuron-specific enolase(NSE)ELISA Kit
GA-E0954HM-96T	GenAsia Biotech	96T	EUR 466

Rat Neuron-specific enolase(NSE)ELISA Kit
GA-E0549RT-48T	GenAsia Biotech	48T	EUR 317

Rat Neuron-specific enolase(NSE)ELISA Kit
GA-E0549RT-96T	GenAsia Biotech	96T	EUR 496

Rabbit Neuron-specific enolase,NSE ELISA Kit
GA-E0147RB-48T	GenAsia Biotech	48T	EUR 326

Rabbit Neuron-specific enolase,NSE ELISA Kit
GA-E0147RB-96T	GenAsia Biotech	96T	EUR 524

Rat NSE(Neuron Specific Enolase) ELISA Kit
ER1200	FN Test	96T	EUR 476.25
Detection range: 0.313-20 ng/ml Uniprot ID: P07323 Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.188 ng/ml

Sheep NSE(Neuron-Specific Enolase) ELISA Kit
ESH0022	FN Test	96T	EUR 567.6
Detection range: 3.125-200 ng/ml Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Sheep;Sensitivity: 1.875 ng/ml

Human Neuron-specific enolase,NSE ELISA Kit
201-12-0938	SunredBio	96 tests	EUR 440
This Neuron-specific enolase ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Neuron-specific enolase, NSE ELISA Kit
CSB-E07961h-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitative sandwich ELISA kit for measuring Human Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Neuron-specific enolase, NSE ELISA Kit
1-CSB-E07961h	Cusabio	EUR 703.00 EUR 4843.00 EUR 2570.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitative sandwich ELISA kit for measuring Human Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Neuron-specific enolase, NSE ELISA Kit
CSB-E07963r-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Neuron-specific enolase, NSE ELISA Kit
1-CSB-E07963r	Cusabio	EUR 967.00 EUR 5925.00 EUR 3134.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Pig Neuron-specific enolase, NSE ELISA Kit
CSB-E14065p-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Pig Neuron-specific enolase, NSE ELISA Kit
1-CSB-E14065p	Cusabio	EUR 967.00 EUR 5925.00 EUR 3134.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Neuron-specific enolase,NSE ELISA Kit
CN-01476R1	ChemNorm	96T	EUR 442

Rat Neuron-specific enolase,NSE ELISA Kit
CN-01476R2	ChemNorm	48T	EUR 293

Human Neuron-specific enolase,NSE ELISA Kit
CN-03318H1	ChemNorm	96T	EUR 455

Human Neuron-specific enolase,NSE ELISA Kit
CN-03318H2	ChemNorm	48T	EUR 304

Rabbit Neuron-specific enolase,NSE ELISA Kit
CN-00683R1	ChemNorm	96T	EUR 464

Rabbit Neuron-specific enolase,NSE ELISA Kit
CN-00683R2	ChemNorm	48T	EUR 313

Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4273.35
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 439.57
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 585.1
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2332.95
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Enolase, Neuron Specific (NSE) ELISA Kit
4-SEA537Hu	Cloud-Clone	EUR 4324.00 EUR 2283.00 EUR 586.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2 Enolase 2 Gamma Enolase 2-phospho-D-glycerate hydro-lyase Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4626.78
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 468.68
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 626.68
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2520.06
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Rat Enolase, Neuron Specific (NSE) ELISA Kit
4-SEA537Ra	Cloud-Clone	EUR 4677.00 EUR 2471.00 EUR 627.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2 Enolase 2 Gamma Enolase 2-phospho-D-glycerate hydro-lyase Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4626.78
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<1 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 468.68
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<1 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 626.68
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<1 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2520.06
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<1 Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
4-SEA537Rb	Cloud-Clone	EUR 4677.00 EUR 2471.00 EUR 627.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2 Enolase 2 Gamma Enolase 2-phospho-D-glycerate hydro-lyase Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rabbit Enolase, Neuron Specific (NSE) in samples from Serum, plasma, tissue homogenates, cell lysates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Enolase, Neuron Specific ELISA Kit (NSE)
RK01966	Abclonal	96 Tests	EUR 521

Rabbit Enolase, Neuron Specific ELISA Kit (NSE)
RK03429	Abclonal	96 Tests	EUR 521

Rat Enolase, Neuron Specific ELISA Kit (NSE)
RK03850	Abclonal	96 Tests	EUR 521

Human Neuron-specific enolase(NSE)ELISA Kit
QY-E01645	Qayee Biotechnology	96T	EUR 394

Rat Neuron-specific enolase(NSE)ELISA Kit
QY-E11103	Qayee Biotechnology	96T	EUR 361

Rabbit Neuron-specific enolase,NSE ELISA Kit
QY-E30152	Qayee Biotechnology	96T	EUR 374

ELISA kit for Mouse NSE (Neuron Specific Enolase)
E-EL-M0089	Elabscience Biotech	1 plate of 96 wells	EUR 377
Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse NSE. Standards or samples are added to the micro ELISA plate wells and combined with the Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Mouse NSE (Enolase, Neuron Specific)
ELK2588	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

NSE ELISA Kit| Mouse Neuron-Specific Enolase ELISA Kit
EF013790	Lifescience Market	96 Tests	EUR 689

Polyclonal Neuron Specific Enolase (NSE) Antibody
APR08718G	Leading Biology	0.1ml	EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Neuron Specific Enolase (NSE) . This antibody is tested and proven to work in the following applications:

Polyclonal Neuron-Specific Enolase (NSE) Antibody
APR08719G	Leading Biology	0.1mg	EUR 528
Description: A polyclonal antibody raised in Chicken that recognizes and binds to Human Neuron-Specific Enolase (NSE) . This antibody is tested and proven to work in the following applications:

Rabbit Enolase, Neuron Specific (NSE) Protein
20-abx653280	Abbexa	EUR 648.00 EUR 272.00 EUR 1998.00 EUR 773.00 EUR 467.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Neuron-Specific Enolase (NSE) Protein
abx670067-50ug	Abbexa	50 ug	EUR 300
Shipped within 1 week.

Human Enolase, Neuron Specific (NSE) Protein
20-abx066423	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Enolase, Neuron Specific (NSE) Protein
20-abx066426	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-12 working days.

Enolase, Neuron Specific (NSE) Antibody (APC)
20-abx176282	Abbexa	EUR 1177.00 EUR 578.00	1 mg 200 ug
Please enquire.

Enolase, Neuron Specific (NSE) Antibody (FITC)
20-abx273791	Abbexa	EUR 453.00 EUR 244.00 EUR 1288.00 EUR 620.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Enolase, Neuron Specific (NSE) Antibody (FITC)
20-abx274000	Abbexa	EUR 453.00 EUR 244.00 EUR 1316.00 EUR 634.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Enolase, Neuron Specific (NSE) Antibody (FITC)
20-abx274136	Abbexa	EUR 467.00 EUR 244.00 EUR 1386.00 EUR 648.00 EUR 356.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Enolase, Neuron Specific (NSE) Antibody Pair
20-abx370057	Abbexa	EUR 1595.00 EUR 1024.00	10 × 96 tests 5 × 96 tests
Shipped within 5-15 working days.

Enolase, Neuron Specific (NSE) Antibody (Biotin)
20-abx271998	Abbexa	EUR 425.00 EUR 230.00 EUR 1191.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Enolase, Neuron Specific (NSE) Antibody (Biotin)
20-abx272702	Abbexa	EUR 425.00 EUR 230.00 EUR 1219.00 EUR 592.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-12 working days.

Enolase, Neuron Specific (NSE) Antibody (Biotin)
20-abx273178	Abbexa	EUR 453.00 EUR 244.00 EUR 1288.00 EUR 620.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Recombinant Neuron-Specific Enolase (NSE)
6362-100	Biovision		EUR 457

Anti-Neuron Specific Enolase (NSE) Antibody
M02930-2	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Neuron Specific Enolase (NSE) Antibody. Validated in IF, IHC, ICC, WB and tested in Human, Mouse, Rat.

Anti-NSE (Neuron specific enolase) antibody
STJ120175	St John's Laboratory	100 µl	EUR 469

Human Neuron Specific Enolase (NSE) ELISA (4X96T)
LF-EK0170	Abfrontier	4×96T	EUR 2045

Human Neuron Specific Enolase (NSE) ELISA (10X96T)
LF-EK0171	Abfrontier	10×96T	EUR 4484

Human Neuron Specific Enolase (NSE) ELISA (20X96T)
LF-EK0172	Abfrontier	20×96T	EUR 7808

Human Neuron-Specific Enolase (NSE) CLIA Kit
abx195569-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

CLIA kit for Mouse NSE (Neuron-Specific Enolase)
E-CL-M0076	Elabscience Biotech	1 plate of 96 wells	EUR 584
Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse NSE . Standards or samples are added to the micro CLIA plate wells and combined with the sp Show more
Description: A sandwich CLIA kit for quantitative measurement of Mouse NSE (Neuron-Specific Enolase) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human NSE (Enolase, Neuron Specific)
ELK2587	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Rat NSE (Enolase, Neuron Specific)
ELK2589	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Rabbit NSE (Enolase, Neuron Specific)
ELK3039	ELK Biotech	1 plate of 96 wells	EUR 526
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Rabbit in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Porcine NSE (Neuron Specific Enolase)
E-EL-P2068	Elabscience Biotech	1 plate of 96 wells	EUR 520
Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Porcine NSE. Standards or samples are added to the micro ELISA plate wells and combined with th Show more
Description: A sandwich ELISA kit for quantitative measurement of Porcine NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Rat NSE (Neuron Specific Enolase)
E-EL-R0058	Elabscience Biotech	1 plate of 96 wells	EUR 377
Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat NSE. Standards or samples are added to the micro ELISA plate wells and combined with the sp Show more
Description: A sandwich ELISA kit for quantitative measurement of Rat NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human NSE (Neuron Specific Enolase)
E-EL-H1047	Elabscience Biotech	1 plate of 96 wells	EUR 377
Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human NSE. Standards or samples are added to the micro ELISA plate wells and combined with the Show more
Description: A sandwich ELISA kit for quantitative measurement of Human NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant

NSE ELISA Kit| Sheep Neuron-Specific Enolase ELISA Kit
EF019517	Lifescience Market	96 Tests	EUR 689

NSE ELISA Kit| Rat Neuron Specific Enolase ELISA Kit
EF017922	Lifescience Market	96 Tests	EUR 689

ELISA kit for Rat Neuron-Specific Enolase (NSE)  Kit
KTE101048-48T	Abbkine	48T	EUR 354
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Neuron-Specific Enolase (NSE)  Kit
KTE101048-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2252
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Neuron-Specific Enolase (NSE)  Kit
KTE101048-96T	Abbkine	96T	EUR 572
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse)
4-PAA537Hu02	Cloud-Clone	EUR 232.00 EUR 2285.00 EUR 574.00 EUR 289.00 EUR 208.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE)

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse)
4-MAA537Hu22	Cloud-Clone	EUR 225.00 EUR 2173.00 EUR 548.00 EUR 279.00 EUR 205.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE)

CLIA kit for Human NSE (Neuron-Specific Enolase)
E-CL-H0702	Elabscience Biotech	1 plate of 96 wells	EUR 584
Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human NSE . Standards or samples are added to the micro CLIA plate wells and combined with the sp Show more
Description: A sandwich CLIA kit for quantitative measurement of Human NSE (Neuron-Specific Enolase) in samples from Serum, Plasma, Cell supernatant

CLIA kit for Rat NSE (Neuron Specific Enolase)
E-CL-R0047	Elabscience Biotech	1 plate of 96 wells	EUR 584
Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat NSE . Standards or samples are added to the micro CLIA plate wells and combined with the spec Show more
Description: A sandwich CLIA kit for quantitative measurement of Rat NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
4-PAA537Hu01	Cloud-Clone	EUR 232.00 EUR 2285.00 EUR 574.00 EUR 289.00 EUR 208.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Met1~Leu434) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), APC
4-PAA537Hu02-APC	Cloud-Clone	EUR 323.00 EUR 2969.00 EUR 836.00 EUR 409.00 EUR 210.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with APC.

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Biotinylated
4-PAA537Hu02-Biotin	Cloud-Clone	EUR 295.00 EUR 2235.00 EUR 671.00 EUR 358.00 EUR 212.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin.

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Cy3
4-PAA537Hu02-Cy3	Cloud-Clone	EUR 390.00 EUR 3917.00 EUR 1073.00 EUR 504.00 EUR 239.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3.

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), FITC
4-PAA537Hu02-FITC	Cloud-Clone	EUR 279.00 EUR 2395.00 EUR 688.00 EUR 347.00 EUR 188.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), HRP
4-PAA537Hu02-HRP	Cloud-Clone	EUR 297.00 EUR 2589.00 EUR 741.00 EUR 371.00 EUR 199.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with HRP.

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), PE
4-PAA537Hu02-PE	Cloud-Clone	EUR 279.00 EUR 2395.00 EUR 688.00 EUR 347.00 EUR 188.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with PE.

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
4-PAA537Mu01	Cloud-Clone	EUR 236.00 EUR 2338.00 EUR 586.00 EUR 294.00 EUR 209.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Met1~Leu434) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
4-PAA537Mu02	Cloud-Clone	EUR 236.00 EUR 2338.00 EUR 586.00 EUR 294.00 EUR 209.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu434) Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)

Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
4-PAA537Ra01	Cloud-Clone	EUR 243.00 EUR 2457.00 EUR 613.00 EUR 305.00 EUR 212.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: NSE (Ser2~Leu434) Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), APC
4-MAA537Hu22-APC	Cloud-Clone	EUR 313.00 EUR 2816.00 EUR 798.00 EUR 394.00 EUR 206.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with APC.

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Biotinylated
4-MAA537Hu22-Biotin	Cloud-Clone	EUR 287.00 EUR 2123.00 EUR 643.00 EUR 347.00 EUR 209.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin.

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Cy3
4-MAA537Hu22-Cy3	Cloud-Clone	EUR 375.00 EUR 3713.00 EUR 1022.00 EUR 483.00 EUR 233.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3.

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), FITC
4-MAA537Hu22-FITC	Cloud-Clone	EUR 270.00 EUR 2272.00 EUR 658.00 EUR 335.00 EUR 184.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), HRP
4-MAA537Hu22-HRP	Cloud-Clone	EUR 288.00 EUR 2457.00 EUR 708.00 EUR 358.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with HRP.

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), PE
4-MAA537Hu22-PE	Cloud-Clone	EUR 270.00 EUR 2272.00 EUR 658.00 EUR 335.00 EUR 184.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with PE.

Human brain neuron-specific enolase (NSE/gamma enolase) protein (purified)
NSE15-N-100	Alpha Diagnostics	100 ug	EUR 408

Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat)
4-MAA537Hu21	Cloud-Clone	EUR 241.00 EUR 2417.00 EUR 604.00 EUR 301.00 EUR 211.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Met1~Leu434 Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE)

Neuron Specific Enolase
PR27173	Neuromics	25 ug	EUR 318

Mouse NSE(Enolase, Neuron Specific) ELISA Kit